PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g010930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 767aa    MW: 85427.7 Da    PI: 5.4845
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g010930.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS377.22.1e-1153917611373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+avs +d + a+++L +++e++sp g+  +Rla+yf++ L+arla++++++y al++++ts    ++ l+a++++  v+P+ k + 
  Csa03g010930.1 391 LRTLLVLCAQAVSVDDRRTANEMLRQIREHSSPLGNGSERLAHYFANSLEARLAGTGTQIYTALSSKKTS---AADMLKAYQTYMSVCPFKKAAI 482
                     5789**************************************************************9999...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN+ +++ +++++++HiiDf+is+G+QWpaL++ L+ Rp+g+p+lRiTg++ p+ g   +e ++etg+rLa+++++ +vpfe+n+ +a+++e+
  Csa03g010930.1 483 IFANHSLMRFTANASTIHIIDFGISYGFQWPALIHRLSLRPGGSPKLRITGIELPQRGfrPAEGVQETGHRLARYCQRHNVPFEYNA-IAQKWET 576
                     ********************************************************99*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L++++gE +aVn+ ++ ++llde+v ++s+rd+vLkl+++++P+v++ +    ++n++ F++rf eal +ysa+fd+ ++kl re+e r 
  Csa03g010930.1 577 IKVEDLKLRQGEFVAVNSLFRFKNLLDETVLVNSPRDAVLKLIRKVNPNVFIPAILSGNYNAPFFVTRFREALFHYSAVFDMCDSKLTREDEMRL 671
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + E+e+ grei nvvaceg+er+er et+++W+ rl +aGF+++pl+++ +++ kl + + +++ + v+++s++l++gWk+r +++ S W
  Csa03g010930.1 672 MFEKEFYGREIINVVACEGTERVERPETYKQWQVRLIRAGFRQLPLEKELMQNLKLKIDNGYDKNFDVDQNSNWLLQGWKGRIVYASSIW 761
                     **************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.602365742IPR005202Transcription factor GRAS
PfamPF035147.3E-113391761IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MGSYPDGFPG SMDQFDFTSE FDLPASNDTT LGLVASNGFY LDEPFLNFAS MDPPPPQSYP  60
QNNKAASGGD LLSSPSDDAD FSDSVLKYIS QVLMEEDMEE KPCMFHDALA LQAAEKSLYE  120
ALGEKYPSSS SSASVDHPEK LTHDSPDGSC SGGAFSDYAS TTTTTSSDSH WSVDGFENRS  180
SWLQSPMPSN FVFQSTSRSN SVTVGGVGNR SGFGDDLVSN MFKDSELAMQ FKRGVEEASK  240
FLPKSSQLFI DVDSYIPSNS GSKENGSEVF VKTEKKDETE HHSSALPPNR LTGKKSHWRD  300
DDEDSVEERS NKQSAVYVEE SELSEMFDKI LLCGPGKPVC ILDQKFPAEP ANVETAQQIA  360
VQSNGAKIRG KKSTATTSLS NDSGKKETAD LRTLLVLCAQ AVSVDDRRTA NEMLRQIREH  420
SSPLGNGSER LAHYFANSLE ARLAGTGTQI YTALSSKKTS AADMLKAYQT YMSVCPFKKA  480
AIIFANHSLM RFTANASTIH IIDFGISYGF QWPALIHRLS LRPGGSPKLR ITGIELPQRG  540
FRPAEGVQET GHRLARYCQR HNVPFEYNAI AQKWETIKVE DLKLRQGEFV AVNSLFRFKN  600
LLDETVLVNS PRDAVLKLIR KVNPNVFIPA ILSGNYNAPF FVTRFREALF HYSAVFDMCD  660
SKLTREDEMR LMFEKEFYGR EIINVVACEG TERVERPETY KQWQVRLIRA GFRQLPLEKE  720
LMQNLKLKID NGYDKNFDVD QNSNWLLQGW KGRIVYASSI WVPSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-463957618374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010487566.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLR0IBA10.0R0IBA1_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0001_6970.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14